Fan, L.; Warnecke, A.; Weder, J.; Preller, M.; Zeilinger, C.: Triiodothyronine Acts as a Smart Influencer on Hsp90 via a Triiodothyronine Binding Site. In: International journal of molecular sciences 23 (2022), Nr. 13, 7150. DOI: https://doi.org/10.3390/ijms23137150
Zusammenfassung: | |
Microarray-based experiments revealed that thyroid hormone triiodothyronine (T3) enhanced the binding of Cy5-labeled ATP on heat shock protein 90 (Hsp90). By molecular docking experiments with T3 on Hsp90, we identified a T3 binding site (TBS) near the ATP binding site on Hsp90. A synthetic peptide encoding HHHHHHRIKEIVKKHSQFIGYPITLFVEKE derived from the TBS on Hsp90 showed, in MST experiments, the binding of T3 at an EC50 of 50 μM. The binding motif can influence the activity of Hsp90 by hindering ATP accessibility or the release of ADP. | |
Lizenzbestimmungen: | CC BY 4.0 Unported |
Publikationstyp: | Article |
Publikationsstatus: | publishedVersion |
Erstveröffentlichung: | 2022 |
Die Publikation erscheint in Sammlung(en): | Naturwissenschaftliche Fakultät |
Pos. | Land | Downloads | ||
---|---|---|---|---|
Anzahl | Proz. | |||
1 | ![]() |
Germany | 13 | 36,11% |
2 | ![]() |
United States | 10 | 27,78% |
3 | ![]() |
China | 5 | 13,89% |
4 | ![]() |
Taiwan | 3 | 8,33% |
5 | ![]() |
Indonesia | 1 | 2,78% |
6 | ![]() |
Hong Kong | 1 | 2,78% |
7 | ![]() |
Greece | 1 | 2,78% |
8 | ![]() |
Denmark | 1 | 2,78% |
9 | ![]() |
Australia | 1 | 2,78% |
Hinweis
Zur Erhebung der Downloadstatistiken kommen entsprechend dem „COUNTER Code of Practice for e-Resources“ international anerkannte Regeln und Normen zur Anwendung. COUNTER ist eine internationale Non-Profit-Organisation, in der Bibliotheksverbände, Datenbankanbieter und Verlage gemeinsam an Standards zur Erhebung, Speicherung und Verarbeitung von Nutzungsdaten elektronischer Ressourcen arbeiten, welche so Objektivität und Vergleichbarkeit gewährleisten sollen. Es werden hierbei ausschließlich Zugriffe auf die entsprechenden Volltexte ausgewertet, keine Aufrufe der Website an sich.